Part of scaffold_6 (Scaffold)

For more information consult the page for scaffold_6 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

GHRL ENSTTRG00000007563 (Bottlenosed dolphin)

Gene Details

ghrelin/obestatin prepropeptide

External Links

Gene match (Ensembl Protein ID: ENSTTRP00000007153, Bottlenosed dolphin)

Protein Percentage 46.25%
cDNA percentage 47.5%
Ka/Ks Ratio 0.49449 (Ka = 0.115, Ks = 0.2327)

GHRL ENSBTAG00000012328 (Cow)

Gene Details

Appetite-regulating hormone Ghrelin Obestatin

External Links

Gene match (Ensembl Protein ID: ENSBTAP00000041811, Cow)

Protein Percentage 62.79%
cDNA percentage 77.13%
Ka/Ks Ratio 0.77534 (Ka = 0.2772, Ks = 0.3575)

GHRL  (Minke Whale)

Gene Details

ghrelin/obestatin prepropeptide

External Links

Gene match (Identifier: BACU015172, Minke Whale)

Protein Percentage 98.84%
cDNA percentage 98.45%
Ka/Ks Ratio 0.12236 (Ka = 0.0054, Ks = 0.0445)

Additional orthologs identified in other species via the OPTIC pipeline.

Genome Location

Sequence Coding sequence

Length: 258 bp    Location:2691727..2694847   Strand:+
>bmy_00431
AGAAAGGAATCCAAGAAGCTGTCAGCCAAACCAAAGCCCCGGGCCCTGGAAGGCTGGCTTGACGCAGAAGTCAGAAGTCAGGCGGAAGGCGCAGGGGACGAGCTGGAAATCCAGTTCAGTGCCCCCTTTGACGTTGGGATCAAGCTGTCAGGGGCTCACTCCCACCAGCATGGCCAGACCCTGGGGAAGTTTCTTCAGGACGTCCTTTGGGAAGACGCCAGTGCTAAGTCCTTTCTCCAGTTTCCTCGGAGTCCCAAT

Related Sequences

bmy_00431T0 Protein

Length: 86 aa      View alignments
>bmy_00431T0
RKESKKLSAKPKPRALEGWLDAEVRSQAEGAGDELEIQFSAPFDVGIKLSGAHSHQHGQTLGKFLQDVLWEDASAKSFLQFPRSPN