Part of scaffold_14 (Scaffold)

For more information consult the page for scaffold_14 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

ENSTTRG00000003666 (Bottlenosed dolphin)

Gene Details

External Links

Gene match (Ensembl Protein ID: ENSTTRP00000003437, Bottlenosed dolphin)

Protein Percentage 85.94%
cDNA percentage 88.02%
Ka/Ks Ratio 0.78379 (Ka = 0.125, Ks = 0.1595)

TMEM14C ENSBTAG00000005808 (Cow)

Gene Details

Transmembrane protein 14C

External Links

Gene match (Ensembl Protein ID: ENSBTAP00000007635, Cow)

Protein Percentage 84.38%
cDNA percentage 82.81%
Ka/Ks Ratio 0.31653 (Ka = 0.1302, Ks = 0.4113)

Additional orthologs identified in other species via the OPTIC pipeline.

Genome Location

Sequence Coding sequence

Length: 192 bp    Location:196635..192346   Strand:-
>bmy_00845
GTGCCTTTACATTGGATCGGCTTTGGCTATGCGGCACTGGTTGCTTCCGGCGGGATCATTGGCTATGCAAAAGCAGTTACATCTGGAACCTTGGCTGGCATTATGGGAATGAGATTCTACCACTCTGGAAAATTTATGCCTGCAGGCTTAATTGCAGGTGCCAGTATATCTGATACTGAGCATCGACTGAAA

Related Sequences

bmy_00845T0 Protein

Length: 64 aa      View alignments
>bmy_00845T0
VPLHWIGFGYAALVASGGIIGYAKAVTSGTLAGIMGMRFYHSGKFMPAGLIAGASISDTEHRLK