Part of scaffold_17 (Scaffold)

For more information consult the page for scaffold_17 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

Genome Location

Sequence Coding sequence

Length: 192 bp    Location:567069..563778   Strand:-
>bmy_00875
ATGCCTTTTCTCGGGGAGCCTGTAATGGAGAAAGTATTTTCATACTTGTCAACCATTCCATTAGAAGAATGTACTGGAAATGTACTAAATATGACACTTTATGATGATCAAAAAGATGACAACATTAAGGGAATATTTACACGAAGAAATACAGAGGTTGAAATACAAAACCTTCAACATAATATTGAATGA

Related Sequences

bmy_00875T0 Protein

Length: 64 aa     
>bmy_00875T0
MPFLGEPVMEKVFSYLSTIPLEECTGNVLNMTLYDDQKDDNIKGIFTRRNTEVEIQNLQHNIE*