Sequence details bmy_01099 (Coding sequence)

Part of scaffold_21 (Scaffold)

For more information consult the page for scaffold_21 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

MRPL33 ENSBTAG00000035199 (Cow)

Gene Details

39S ribosomal protein L33, mitochondrial

External Links

Gene match (Ensembl Protein ID: ENSBTAP00000056434, Cow)

Protein Percentage 81.63%
cDNA percentage 87.07%
Ka/Ks Ratio 0.4026 (Ka = 0.1076, Ks = 0.2673)

Additional orthologs identified in other species via the OPTIC pipeline.

MRPL33 (Human)   Mrpl33 (Mouse)  

Genome Location

Sequence Coding sequence

Length: 156 bp    Location:2157150..2160032   Strand:+
Raw sequence 
>bmy_01099
ATGTTCCTGTCCGCGGTCACCTCTTGTAACAACTTGCTTTTAAATCTTAGAACAATTCTGGTGAAAATGTTGAGCCAAGCTGGAACAGGTTTTTCCTTCAACACTAAGAGAAGCCGACTACGGGAGAAACTGACTCTCTTGCATTATGATCCAGTA

Related Sequences

bmy_01099T0 Protein

Length: 52 aa      
>bmy_01099T0
MFLSAVTSCNNLLLNLRTILVKMLSQAGTGFSFNTKRSRLREKLTLLHYDPV