Part of scaffold_21 (SequenceType object (1))

For more information consult the page for scaffold_21 (SequenceType object (1))

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

MRPL33ENSBTAG00000035199 (Cow)

Gene Details

39S ribosomal protein L33, mitochondrial

External Links

Gene match(Ensembl Protein ID:ENSBTAP00000056434, Cow)

Protein Percentage 81.63%
cDNA percentage 87.07%
Ka/Ks Ratio 0.4026 (Ka = 0.1076, Ks = 0.2673)

Additional orthologs identified in other species via the OPTIC pipeline.

Genome Location

Sequence SequenceType object (2)

Length: 156 bp    Location:2157150..2160032   Strand:+
>bmy_01099
ATGTTCCTGTCCGCGGTCACCTCTTGTAACAACTTGCTTTTAAATCTTAGAACAATTCTGGTGAAAATGTTGAGCCAAGCTGGAACAGGTTTTTCCTTCAACACTAAGAGAAGCCGACTACGGGAGAAACTGACTCTCTTGCATTATGATCCAGTA

Related Sequences

bmy_01099T0 SequenceType object (3)

Length: 52 aa     
>bmy_01099T0
MFLSAVTSCNNLLLNLRTILVKMLSQAGTGFSFNTKRSRLREKLTLLHYDPV