Part of scaffold_75 (Scaffold)

For more information consult the page for scaffold_75 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

INSL3 ENSBTAG00000025775 (Cow)

Gene Details

Insulin-like 3 Insulin-like 3 B' chain Insulin-like 3 B chain Insulin-like 3 A chain

External Links

Gene match (Ensembl Protein ID: ENSBTAP00000027848, Cow)

Protein Percentage 91.6%
cDNA percentage 91.35%
Ka/Ks Ratio 0.15015 (Ka = 0.0405, Ks = 0.2695)

Additional orthologs identified in other species via the OPTIC pipeline.

Genome Location

Sequence Coding sequence

Length: 402 bp    Location:849774..848146   Strand:-
>bmy_02607
ATGGACCCCCGTCGGCTCACCTGGGCGCTGGTGCTGCTGGGCCCGGCCCTGGCGCTCGCCCTAGGCCCTGCCCCCGCCCAGGAGGCGCCCGAGAAGCTGTGCGGCCACCACTTCGTGCGCGCGCTTGTGCGGCTGTGCGGAGGCCCGCGCTGGTCCCCCGAGGATGGGCGACCTGTGGCTGGCGGCGACCGTGAGCTGCTACAGTGGCTGGAAGGACAACATCTCCTCCAAGGGCTGATGGCCAGTGGGGACCCCGTGCTGGTACTCGCCCCACAGCCCCTGCCCCAGGCCTCCAGCCATCACCACCACCCCCACCGCCGGGCAGCTGCCACCAACCCTGTCCGTCACTGCTGCCTCAGTGGCTGCACCCGGCAAGACCTGCTGACCCTCTGTCCCCACTGA

Related Sequences

bmy_02607T0 Protein

Length: 134 aa      View alignments
>bmy_02607T0
MDPRRLTWALVLLGPALALALGPAPAQEAPEKLCGHHFVRALVRLCGGPRWSPEDGRPVAGGDRELLQWLEGQHLLQGLMASGDPVLVLAPQPLPQASSHHHHPHRRAAATNPVRHCCLSGCTRQDLLTLCPH*