Sequence detailsbmy_02849 (Coding sequence)

Part of scaffold_79 (SequenceType object (1))

For more information consult the page for scaffold_79 (SequenceType object (1))

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

GRHPR (Cow)   GRHPR (Human)   Grhpr (Mouse)  

Genome Location

Sequence SequenceType object (2)

Length: 213 bp    Location:1028212..1027186   Strand:-
Raw sequence 
>bmy_02849
ATGAAGAAAACAGAAGACAACAACACACCGGTGTTCATTGTGGACGTCAAAACCAACAAGCACCAGATTAAACAGGCTGTGAAGAAGCTCTGTGACACTGACGTGACTAAGGTCAACACCCTGACCAGGCCCGATGGAGAGAAGAAGGCATATGTTCGACTGGTTCCTGACTATGATGCTTTGGATGTTGCCAACAAAATTGGGATCAAATAA

Related Sequences

bmy_02849T0 SequenceType object (3)

Length: 71 aa      
>bmy_02849T0
MKKTEDNNTPVFIVDVKTNKHQIKQAVKKLCDTDVTKVNTLTRPDGEKKAYVRLVPDYDALDVANKIGIK*