Part of scaffold_161 (Scaffold)

For more information consult the page for scaffold_161 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

Genome Location

Sequence Coding sequence

Length: 204 bp    Location:617344..621822   Strand:+
>bmy_04761
ATGCAGGCGTTTTCGGAAGAGGAGAGGAAGCAGTGGTTGGAAGCTCTGGGTGGAAAAGAAGCTCTGTTCCCTAGTTTTAATAGAGCCATCATCCCAAGACCAGAAGGAAGTGCACAGTTGGATAAGATGGGATTCACAATTCTTAGAAAATGCATCAGTGCAGTTGAAACACGAGGTAACATGATTGAATCATTTTATTCATGA

Related Sequences

bmy_04761T0 Protein

Length: 68 aa     
>bmy_04761T0
MQAFSEEERKQWLEALGGKEALFPSFNRAIIPRPEGSAQLDKMGFTILRKCISAVETRGNMIESFYS*