Sequence details bmy_04961 (Coding sequence)

Part of scaffold_171 (Scaffold)

For more information consult the page for scaffold_171 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

NLRP6 (Cow)   NLRP6 (Human)   Nlrp6 (Mouse)  

Genome Location

Sequence Coding sequence

Length: 264 bp    Location:75232..75495   Strand:+
Raw sequence 
>bmy_04961
ATGGAGCCCCGCGCTGCCGCCGCCCGGGAGCTGCTCCTGGCTGCGCTCGAAGACCTAAGCCAGGAGCGGTTGAAGCGCTTCCGCGACAAGCTGCGGGACGCGCCGCTGGACGGCCGCCGCAAACCGTGGGGGCGGCTGGAGGGCGCGGACGCCGTGGACCTCGCGGAGCACCTGATCCATTTCCACGGGCCGGAGCGCGCGCTAGACGCGGCGCGAAAGACCCTGAAGAGGGCGGGCGTGCGCGATGCGGCGGCGCGGCTCTAG

Related Sequences

bmy_04961T0 Protein

Length: 88 aa      
>bmy_04961T0
MEPRAAAARELLLAALEDLSQERLKRFRDKLRDAPLDGRRKPWGRLEGADAVDLAEHLIHFHGPERALDAARKTLKRAGVRDAAARL*