Sequence detailsbmy_06346 (Coding sequence)

Part of scaffold_237 (SequenceType object (1))

For more information consult the page for scaffold_237 (SequenceType object (1))

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

PCP4L1ENSBTAG00000040512 (Cow)

Gene Details

Purkinje cell protein 4-like protein 1

External Links

Gene match(Ensembl Protein ID:ENSBTAP00000053101, Cow)

Protein Percentage 91.18%
cDNA percentage 93.63%
Ka/Ks Ratio 0.32713 (Ka = 0.043, Ks = 0.1313)

Additional orthologs identified in other species via the OPTIC pipeline.

PCP4L1 (Human)   Pcp4l1 (Mouse)  

Genome Location

Sequence SequenceType object (2)

Length: 207 bp    Location:1447148..1469151   Strand:+
Raw sequence 
>bmy_06346
ATGAGCGAGCTTAACACCAAAACATCCCCAGCAACCAACCAGGCAGCTGGCCCAGAGGAAAAGGGGAGAGCTGGCAATACCAAGAAGGCTGAGGAGGAGGAGGAGATTGATATTGATCTGACGGCACCAGAAACAGAGAAGGCTGCCCTTGCTATTCAGGGCAAGTTCCGTCGATTCCAGAAAAAGAAAAAGGATCCCAGTTCCTGA

Related Sequences

bmy_06346T0 SequenceType object (3)

Length: 69 aa      View alignments
>bmy_06346T0
MSELNTKTSPATNQAAGPEEKGRAGNTKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKKKKDPSS*