Part of scaffold_244 (Scaffold)

For more information consult the page for scaffold_244 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

Genome Location

Sequence Coding sequence

Length: 288 bp    Location:426359..426072   Strand:-
>bmy_06496
ATGCCCGGCGCCCGGGTCGCGGCCCACCTGGACGCGCTGGGCCCCTTGGTCCCCTCCGTGCCGCCGCCCCTGCTGCCCTCTATGTTCTACGTGGGCCTGTTCTTCGTCAATGTGCTGATCCTATACTACGCCTTCCTCATGGAGTACATCGTCCTCAACGTGGGCCTCGTATTCCTGCCCGAGGACATGGACCAGGCGCTCGTGGACCTCGGCGTGCTCTCCGACCCCGGCTCGGGCCTCTACGATGCCGACTCGGAGCTCGACGTCTTCGATGGTTACTTGGAGTAG

Related Sequences

bmy_06496T0 Protein

Length: 96 aa     
>bmy_06496T0
MPGARVAAHLDALGPLVPSVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDLGVLSDPGSGLYDADSELDVFDGYLE*