Sequence detailsbmy_06843 (Coding sequence)

Part of scaffold_263 (SequenceType object (1))

For more information consult the page for scaffold_263 (SequenceType object (1))

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

ENSBTAG00000004890 (Cow)

Gene Details

Uncharacterized protein

External Links

Gene match(Ensembl Protein ID:ENSBTAP00000006433, Cow)

Protein Percentage 76.92%
cDNA percentage 84.19%
Ka/Ks Ratio 0.2554 (Ka = 0.1202, Ks = 0.4705)

Genome Location

Sequence SequenceType object (2)

Length: 237 bp    Location:426962..426566   Strand:-
Raw sequence 
>bmy_06843
ATGGTGCCCACTCTCACCAACGTGTCTGCTGGGATCCCCAGCAGCAAAGTGAAATACTCAAAGCTCTCCAGCACTGATGATGGACACATTACCTGCTGCCTCCTGCTGGCAGGCTACATCAGCAAAGTTGGCGCCAACCGAGCCTTTCCAGTTCTGACTGTTGGCGTCCTGGTGTTCCTCCCCAGATTTTACCACCCGATCATTGCATACAGAGCATACCGAGGCTGCCAGGGCTAA

Related Sequences

bmy_06843T0 SequenceType object (3)

Length: 79 aa      
>bmy_06843T0
MVPTLTNVSAGIPSSKVKYSKLSSTDDGHITCCLLLAGYISKVGANRAFPVLTVGVLVFLPRFYHPIIAYRAYRGCQG*