Sequence details bmy_06849 (Coding sequence)

Part of scaffold_263 (Scaffold)

For more information consult the page for scaffold_263 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

TRAPPC3L ENSTTRG00000016547 (Bottlenosed dolphin)

Gene Details

trafficking protein particle complex 3-like

External Links

Gene match (Ensembl Protein ID: ENSTTRP00000015688, Bottlenosed dolphin)

Protein Percentage 88.06%
cDNA percentage 93.03%
Ka/Ks Ratio 0.41316 (Ka = 0.0586, Ks = 0.1419)

Additional orthologs identified in other species via the OPTIC pipeline.

BET3L (Cow)   TRAPPC3L (Human)   Bet3l (Mouse)  

Genome Location

Sequence Coding sequence

Length: 204 bp    Location:562932..571921   Strand:+
Raw sequence 
>bmy_06849
ATGTACTTGGGCATTACACCAAGTGTGACATGTAACAATTCAAGCAGAAATGAATTTTCCCTGATTCCAGACAAGAATCCTCTGGTTCATTTGGCTGCTGATGTTACATTCTTGCAAGACAGACTAAAAGGCGACAGTGTGACAGAAATAGGAATAACATTTCTGAAAAAGCTGGATGAGGAAAAATACAGATGGAAAAAATGA

Related Sequences

bmy_06849T0 Protein

Length: 68 aa      
>bmy_06849T0
MYLGITPSVTCNNSSRNEFSLIPDKNPLVHLAADVTFLQDRLKGDSVTEIGITFLKKLDEEKYRWKK*