Sequence detailsbmy_07950 (Coding sequence)

Part of scaffold_335 (SequenceType object (1))

For more information consult the page for scaffold_335 (SequenceType object (1))

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

DYNLRB2ENSBTAG00000017752 (Cow)

Gene Details

Dynein light chain roadblock-type 2

External Links

Gene match(Ensembl Protein ID:ENSBTAP00000023603, Cow)

Protein Percentage 98.68%
cDNA percentage 95.61%
Ka/Ks Ratio 0.04323 (Ka = 0.0064, Ks = 0.1479)

Additional orthologs identified in other species via the OPTIC pipeline.

DYNLRB2 (Human)   Dynlrb2 (Mouse)  

Genome Location

Sequence SequenceType object (2)

Length: 231 bp    Location:134965..125779   Strand:-
Raw sequence 
>bmy_07950
ATGGTTGTAAATGCAGAAGGCATTCCCATCCGAACGACCTTGGACAACTCGACAACAGTTCAATATGCAGGTCTCCTTCATCAGCTGACCGTGAAAGCCAAGAGCACAGTTCGTGACATTGATCCTCAGAACGACCTAACTTTTCTTAGGATCAGATCAAAGAAACATGAAATCATGGTAGCTCCAGATAAGGAATATCTTCTGATTGTCATTCAGAATCCATGTGAATAG

Related Sequences

bmy_07950T0 SequenceType object (3)

Length: 77 aa      View alignments
>bmy_07950T0
MVVNAEGIPIRTTLDNSTTVQYAGLLHQLTVKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCE*