Sequence details bmy_09696 (Coding sequence)

Part of scaffold_476 (Scaffold)

For more information consult the page for scaffold_476 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

NUP210L (Cow)   NUP210L (Human)   Nup210l (Mouse)  

Genome Location

Sequence Coding sequence

Length: 222 bp    Location:671312..670311   Strand:-
Raw sequence 
>bmy_09696
ATGATGTTTGAGTGGAGCATTGCCCAGGAAAATGAATCAGCAAGAGAAGAACTGTCTAGCAAAATTAGGATTTTGAAATACTCTGAAGCAGAATATTCTCCCCCTGTGTATATAGCTGAGATGGAAAAGGAAGAGAAACAAGGAGATATGATTTTGGTGTCTGGGATTAGAACTGGTGCTGCTGTTGTAAAAGTTCGAATTTCTGAACCATTCTATAAGGTA

Related Sequences

bmy_09696T0 Protein

Length: 74 aa      
>bmy_09696T0
MMFEWSIAQENESAREELSSKIRILKYSEAEYSPPVYIAEMEKEEKQGDMILVSGIRTGAAVVKVRISEPFYKV