Part of scaffold_476 (SequenceType object (1))

For more information consult the page for scaffold_476 (SequenceType object (1))

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

C1orf189ENSTTRG00000015819 (Bottlenosed dolphin)

Gene Details

chromosome 1 open reading frame 189

External Links

Gene match(Ensembl Protein ID:ENSTTRP00000014989, Bottlenosed dolphin)

Protein Percentage 95.38%
cDNA percentage 98.46%
Ka/Ks Ratio 99.0 (Ka = 0.0287, Ks = 0.0003)

C3H1orf189ENSBTAG00000033220 (Cow)

Gene Details

Uncharacterized protein C1orf189 homolog

External Links

Gene match(Ensembl Protein ID:ENSBTAP00000044427, Cow)

Protein Percentage 90.77%
cDNA percentage 92.82%
Ka/Ks Ratio 0.38949 (Ka = 0.0533, Ks = 0.1369)

Additional orthologs identified in other species via the OPTIC pipeline.

Genome Location

Sequence SequenceType object (2)

Length: 195 bp    Location:715785..715003   Strand:-
>bmy_09698
ATGACATTAAGCCAGAGGAGAAACCCATATGCCATCCTAAGGATGCAGGACACTATGGTGCAGGAGTTGGCACTGGCCAACAAGCAATTACTGATGGTCCGTCAAGCTGCCCTGCACCAGCTGTTTGAAAAGGAGCATCGGCAGTACCAACAGGAACTAGATCAGATGGGCAAAGCTTTTTATGTGGAGAGACTC

Related Sequences

bmy_09698T0 SequenceType object (3)

Length: 65 aa      View alignments
>bmy_09698T0
MTLSQRRNPYAILRMQDTMVQELALANKQLLMVRQAALHQLFEKEHRQYQQELDQMGKAFYVERL