Sequence details bmy_11143 (Coding sequence)

Part of scaffold_592 (Scaffold)

For more information consult the page for scaffold_592 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

GOLPH3L (Cow)   GOLPH3L (Human)   Golph3l (Mouse)  

Genome Location

Sequence Coding sequence

Length: 192 bp    Location:583110..585630   Strand:+
Raw sequence 
>bmy_11143
ATGACTACTCACCCAGTGACCAATACAACAGAGAAGCAGCGACTAGTGAAAAAGCTTCAAGACAATGACAAGTATGATGTGGCAATGAATCGGGCCAAGGACCTAGTGGAACTGGACCCTGAGGTAGAGGGGACAAAGCACAGTGCCACAGAGATGATCTGGGCTGTGCTGGCAGCCTTCAATAAATCCTAA

Related Sequences

bmy_11143T0 Protein

Length: 64 aa      
>bmy_11143T0
MTTHPVTNTTEKQRLVKKLQDNDKYDVAMNRAKDLVELDPEVEGTKHSATEMIWAVLAAFNKS*