Sequence detailsbmy_11143 (Coding sequence)

Part of scaffold_592 (SequenceType object (1))

For more information consult the page for scaffold_592 (SequenceType object (1))

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

GOLPH3L (Cow)   GOLPH3L (Human)   Golph3l (Mouse)  

Genome Location

Sequence SequenceType object (2)

Length: 192 bp    Location:583110..585630   Strand:+
Raw sequence 
>bmy_11143
ATGACTACTCACCCAGTGACCAATACAACAGAGAAGCAGCGACTAGTGAAAAAGCTTCAAGACAATGACAAGTATGATGTGGCAATGAATCGGGCCAAGGACCTAGTGGAACTGGACCCTGAGGTAGAGGGGACAAAGCACAGTGCCACAGAGATGATCTGGGCTGTGCTGGCAGCCTTCAATAAATCCTAA

Related Sequences

bmy_11143T0 SequenceType object (3)

Length: 64 aa      
>bmy_11143T0
MTTHPVTNTTEKQRLVKKLQDNDKYDVAMNRAKDLVELDPEVEGTKHSATEMIWAVLAAFNKS*