Part of scaffold_632 (Scaffold)

For more information consult the page for scaffold_632 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

KRTAP8-1 ENSTTRG00000010876 (Bottlenosed dolphin)

Gene Details

keratin associated protein 8-1

External Links

Gene match (Ensembl Protein ID: ENSTTRP00000010309, Bottlenosed dolphin)

Protein Percentage 93.65%
cDNA percentage 96.3%
Ka/Ks Ratio 0.34853 (Ka = 0.0276, Ks = 0.0793)

KRTAP8-1 ENSBTAG00000015812 (Cow)

Gene Details

Uncharacterized protein

External Links

Gene match (Ensembl Protein ID: ENSBTAP00000021000, Cow)

Protein Percentage 85.71%
cDNA percentage 83.6%
Ka/Ks Ratio 0.08383 (Ka = 0.0794, Ks = 0.9471)

Additional orthologs identified in other species via the OPTIC pipeline.

Genome Location

Sequence Coding sequence

Length: 264 bp    Location:926044..926307   Strand:+
>bmy_11582
ATGGAGAGTAGGGAATCCATCACACTGAGGAAACACATTCCACTGCTATCTAAGCCCCCAACTCCAGACACCAAGTGCTATAACAACTTCTCCAGCACTGTCTTCCCAGGATGTTACTGGGGCAGCTACAGCTACCCCCTGGGGTATAGTGTTGGTTGTGGCTACATCAGCACCCACTCCCCAGTGGGCTATGGTTTTGGCTATGGCTACAATGGCTGTGGGGCTTTCGACTACAGAAGATTCTGGCCATTTGGTCTCTATTGA

Related Sequences

bmy_11582T0 Protein

Length: 88 aa      View alignments
>bmy_11582T0
MESRESITLRKHIPLLSKPPTPDTKCYNNFSSTVFPGCYWGSYSYPLGYSVGCGYISTHSPVGYGFGYGYNGCGAFDYRRFWPFGLY*