Sequence detailsbmy_12275 (Coding sequence)

Part of scaffold_719 (SequenceType object (1))

For more information consult the page for scaffold_719 (SequenceType object (1))

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

HAMPENSTTRG00000009312 (Bottlenosed dolphin)

Gene Details

hepcidin antimicrobial peptide

External Links

Gene match(Ensembl Protein ID:ENSTTRP00000008828, Bottlenosed dolphin)

Protein Percentage 85.19%
cDNA percentage 90.12%
Ka/Ks Ratio 0.42139 (Ka = 0.0833, Ks = 0.1977)

Additional orthologs identified in other species via the OPTIC pipeline.

HAMP (Cow)   HAMP (Human)  

Genome Location

Sequence SequenceType object (2)

Length: 249 bp    Location:458015..459622   Strand:+
Raw sequence 
>bmy_12275
ATGGCACTGAACACGCAGATCCGGGCCACCTGCCTCCTGCTTCTCCTCCTGGTCAGCCTGACCAGTGCCTTCGTTCTCCCACCTGAGACAAGACAGCTCGCAGACCTCCAGACCCAGGACACAGCTGGAGACGCAGCTGGCTTGACGCCCGTGCTCCAGAGGCTGAGACGAGACACCCACTTCCCCATGTGCATATTCTGCTGCGGCTGCTGTGGTAAAGGAGGGTGTGGGTTATGCTGCAAAACGTAG

Related Sequences

bmy_12275T0 SequenceType object (3)

Length: 83 aa      
>bmy_12275T0
MALNTQIRATCLLLLLLVSLTSAFVLPPETRQLADLQTQDTAGDAAGLTPVLQRLRRDTHFPMCIFCCGCCGKGGCGLCCKT*