Part of scaffold_719 (Scaffold)

For more information consult the page for scaffold_719 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

COX6B1 ENSTTRG00000002241 (Bottlenosed dolphin)

Gene Details

cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous)

External Links

Gene match (Ensembl Protein ID: ENSTTRP00000002095, Bottlenosed dolphin)

Protein Percentage 98.55%
cDNA percentage 99.52%
Ka/Ks Ratio 99.0 (Ka = 0.0054, Ks = 0.0001)

COX6B1 ENSBTAG00000023487 (Cow)

Gene Details

cytochrome c oxidase subunit 6B1

External Links

Gene match (Ensembl Protein ID: ENSBTAP00000007369, Cow)

Protein Percentage 97.1%
cDNA percentage 96.62%
Ka/Ks Ratio 0.0594 (Ka = 0.0115, Ks = 0.1936)

Additional orthologs identified in other species via the OPTIC pipeline.

Genome Location

Sequence Coding sequence

Length: 207 bp    Location:780685..782052   Strand:+
>bmy_12290
ATGGCAGAGGACATCAATACCAAAATCAAGAACTACCAGACTGCTCCTTTTGACAGCCGCTTCCCCAACCAGAACCAGACGAGGAACTGCTGGCAGAACTACCTGGACTTCCACCGCTGTGAGAAGGCAATGACTGCTAAAGGGGGTGACGTCTCCGTGTGTGAATGGTACCGGCGTGTGTACAAGTCCCTCTGCCCCATATCCTGG

Related Sequences

bmy_12290T0 Protein

Length: 69 aa     
>bmy_12290T0
MAEDINTKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISW