Sequence detailsbmy_13397 (Coding sequence)

Part of scaffold_841 (SequenceType object (1))

For more information consult the page for scaffold_841 (SequenceType object (1))

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

AGR2ENSTTRG00000009872 (Bottlenosed dolphin)

Gene Details

anterior gradient 2 homolog (Xenopus laevis)

External Links

Gene match(Ensembl Protein ID:ENSTTRP00000009359, Bottlenosed dolphin)

Protein Percentage 76.0%
cDNA percentage 83.33%
Ka/Ks Ratio 1.05232 (Ka = 0.1965, Ks = 0.1868)

BT.66886ENSBTAG00000024406 (Cow)

Gene Details

anterior gradient protein 2 homolog precursor

External Links

Gene match(Ensembl Protein ID:ENSBTAP00000033750, Cow)

Protein Percentage 86.0%
cDNA percentage 88.0%
Ka/Ks Ratio 0.44016 (Ka = 0.103, Ks = 0.234)

AGR2 (Minke Whale)

Gene Details

anterior gradient 2

External Links

Gene match (Identifier: BACU000469, Minke Whale)

Protein Percentage 92.0%
cDNA percentage 94.0%
Ka/Ks Ratio 2.08639 (Ka = 0.0729, Ks = 0.0349)

Additional orthologs identified in other species via the OPTIC pipeline.

AGR2 (Human)   Agr2 (Mouse)  

Genome Location

Sequence SequenceType object (2)

Length: 303 bp    Location:25338..34479   Strand:+
Raw sequence 
>bmy_13397
ATGAAGAAGCTTTATACAAATCCAAGACAAGCTTTAAAGAAGACATTTGCTGAAAATAAAGAAATCCAGAAATTGGCAGAGCAGTTTGTCCTCCTCAATCTAGTTTATGAAACAACTGACAAACACCTTTCTCCTGATGGCCAGTACGTCCCCAGGATTATGTTTATTGACCCATCCCTGACAGTTAGAGCCGACATCACTGGAAGATACTCAAATCGTCTCTATGCTTACGAACCTTCGGATATGGCTCTACTGCTTGACAACATGAGGAAAGCTCTCAAGTTCCTGAAGACTGAATTGTAG

Related Sequences

bmy_13397T0 SequenceType object (3)

Length: 101 aa      View alignments
>bmy_13397T0
MKKLYTNPRQALKKTFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFIDPSLTVRADITGRYSNRLYAYEPSDMALLLDNMRKALKFLKTEL*