Part of scaffold_956 (SequenceType object (1))

For more information consult the page for scaffold_956 (SequenceType object (1))

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

TFF3ENSTTRG00000000729 (Bottlenosed dolphin)

Gene Details

trefoil factor 3 (intestinal)

External Links

Gene match(Ensembl Protein ID:ENSTTRP00000000686, Bottlenosed dolphin)

Protein Percentage 88.75%
cDNA percentage 93.75%
Ka/Ks Ratio 0.1944 (Ka = 0.0449, Ks = 0.2309)

BT.56560ENSBTAG00000021276 (Cow)

Gene Details

trefoil factor 3 precursor

External Links

Gene match(Ensembl Protein ID:ENSBTAP00000028349, Cow)

Protein Percentage 93.75%
cDNA percentage 92.92%
Ka/Ks Ratio 0.06951 (Ka = 0.0309, Ks = 0.4449)

TFF3 (Minke Whale)

Gene Details

trefoil factor 3 (intestinal)

External Links

Gene match (Identifier: BACU004398, Minke Whale)

Protein Percentage 90.0%
cDNA percentage 93.33%
Ka/Ks Ratio 0.23721 (Ka = 0.0509, Ks = 0.2147)

Additional orthologs identified in other species via the OPTIC pipeline.

Genome Location

Sequence SequenceType object (2)

Length: 243 bp    Location:722045..725237   Strand:+
>bmy_14104
ATGGAGGCCAGAAAGTTCTGGCTGCTGGTGATGGTCCTGGCCTTGGTGTCCTCCAGCTCGACTGGGCAGTACGTGGGCCTGTCGCCGAACCAGTGCATGGTCCCGGCCAAGGACAGGGTAGACTGCGGCTACCCCGAGGTCACCCCCGAGCAGTGCAACAATCGTGGCTGCTGCTTCGACTCCAGCATCCACGGGGTGCCCTGGTGCTTCAAGCCCCTGCAGGAAGCAGAATGCACCTTCTGA

Related Sequences

bmy_14104T0 SequenceType object (3)

Length: 81 aa      View alignments
>bmy_14104T0
MEARKFWLLVMVLALVSSSSTGQYVGLSPNQCMVPAKDRVDCGYPEVTPEQCNNRGCCFDSSIHGVPWCFKPLQEAECTF*