Part of scaffold_1030 (Scaffold)

For more information consult the page for scaffold_1030 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

Genome Location

Sequence Coding sequence

Length: 255 bp    Location:531606..558144   Strand:+
>bmy_14737
ATGCAAGCGCCTAGCATCTGGCAGTGGGGCCAAGAAAACAAGGTTTATGCATGTATGATGGTCTTTTTCTTGAGCAACATGATTGAGAACCAGTGTATGTCAACAGGTGCATTTGAGATAACTTTGAATGATGTACCTGTGTGGTCTAAGCTGGAATCTGGTCACCTTCCATCCATGCAACAGCTTGTTCAAATTCTTGACAATGAAATGAAGCTCAATGTGCATATGGATTCAATCCCACACCATCGATCATAG

Related Sequences

bmy_14737T0 Protein

Length: 85 aa     
>bmy_14737T0
MQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS*