Part of scaffold_1117 (SequenceType object (1))

For more information consult the page for scaffold_1117 (SequenceType object (1))

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

ATP6V0E1ENSTTRG00000010626 (Bottlenosed dolphin)

Gene Details

ATPase, H+ transporting, lysosomal 9kDa, V0 subunit e1

External Links

Gene match(Ensembl Protein ID:ENSTTRP00000010072, Bottlenosed dolphin)

Protein Percentage 94.94%
cDNA percentage 96.2%
Ka/Ks Ratio 0.159 (Ka = 0.021, Ks = 0.1322)

ATP6V0E1ENSBTAG00000015100 (Cow)

Gene Details

V-type proton ATPase subunit e 1

External Links

Gene match(Ensembl Protein ID:ENSBTAP00000020094, Cow)

Protein Percentage 92.41%
cDNA percentage 94.51%
Ka/Ks Ratio 0.18562 (Ka = 0.0325, Ks = 0.1749)

ATP6V0E1 (Minke Whale)

Gene Details

ATPase, H+ transporting, lysosomal 9kDa, V0 subunit e1

External Links

Gene match (Identifier: BACU019736, Minke Whale)

Protein Percentage 87.34%
cDNA percentage 91.98%
Ka/Ks Ratio 0.30087 (Ka = 0.0587, Ks = 0.1951)

Additional orthologs identified in other species via the OPTIC pipeline.

Genome Location

Sequence SequenceType object (2)

Length: 240 bp    Location:501955..502194   Strand:+
>bmy_15245
ATGGCGTATACTGGCCTCACGGTGCCTCTCATCGTGATCAGCGTGTTCTGGGGCTTCGTCGGCTTCCTGGTGCCCTGGTTCATCCCAAAGGCTCCCAACCGGGGACTCAGCATCACCATGTTGGTGACCTGTTCCGTTTGCTGCTATCTCTTTTGGCTGATTGCAATTCTGGCCCAACTCAACCCTCTCTTTGGACCACAGTTGAAAAATGAAACCATCTGGTACCTCAAGCATCATTGA

Related Sequences

bmy_15245T0 SequenceType object (3)

Length: 80 aa      View alignments
>bmy_15245T0
MAYTGLTVPLIVISVFWGFVGFLVPWFIPKAPNRGLSITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNETIWYLKHH*