Sequence details bmy_15411 (Coding sequence)

Part of scaffold_1156 (Scaffold)

For more information consult the page for scaffold_1156 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

MON2 (Cow)   MON2 (Human)  

Genome Location

Sequence Coding sequence

Length: 153 bp    Location:598552..600615   Strand:+
Raw sequence 
>bmy_15411
ATGCTTTTCCAGGACCTTTGTCAGTTGGTTAATGCTGATGCCCCTTACTGGCTAGTAGGCATGACAGAAATGACCCGAACGTTTGGCCTCGAATTACTTGAGTCAGTCTTGAATGATTTTCCACAAGTCTTTTTACAAGTAAGCCATTTGTAG

Related Sequences

bmy_15411T0 Protein

Length: 51 aa      
>bmy_15411T0
MLFQDLCQLVNADAPYWLVGMTEMTRTFGLELLESVLNDFPQVFLQVSHL*