Sequence details bmy_15483 (Coding sequence)

Part of scaffold_1163 (Scaffold)

For more information consult the page for scaffold_1163 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

DNAJC24 (Cow)   DNAJC24 (Human)   Dnajc24 (Mouse)  

Genome Location

Sequence Coding sequence

Length: 225 bp    Location:524353..497836   Strand:-
Raw sequence 
>bmy_15483
ATGTTCCATTGGAGACAACAGCAAGATGATCTAAGAAATATGGGACCAGTAGATGCTCGAGTATATCTTGAAGAAATGTCTTGGAATGAAGATGATCATTCTTTTTCTCTGAGTTGTCGATGTGGTGGAAAATACAGTGTTTCCAAGGATGAAGCAGAAGAAGTGACGCTGATTTCTTGTGATACCTCAGAGAAGAAAGCCTGCATTTTAAGCAGAAAACAGTAG

Related Sequences

bmy_15483T0 Protein

Length: 75 aa      
>bmy_15483T0
MFHWRQQQDDLRNMGPVDARVYLEEMSWNEDDHSFSLSCRCGGKYSVSKDEAEEVTLISCDTSEKKACILSRKQ*