Sequence detailsbmy_17194 (Coding sequence)

Part of scaffold_1454 (SequenceType object (1))

For more information consult the page for scaffold_1454 (SequenceType object (1))

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

(Cow)   1700086L19Rik (Mouse)  

Genome Location

Sequence SequenceType object (2)

Length: 156 bp    Location:22219..11141   Strand:-
Raw sequence 
>bmy_17194
ATGGTACAGGAATGCTGTTCTCAGTCTCTCTATTACGAAGAGCTGCATTCGTATCATATTGTGCCTTATGCTTCGGAGAATGCCATTTATGGAATGGGCTACACTAGCAGCCACTTGGAGCAAAATTCTCAGTTGCTTATTTATAAAATGAATTAA

Related Sequences

bmy_17194T0 SequenceType object (3)

Length: 52 aa      
>bmy_17194T0
MVQECCSQSLYYEELHSYHIVPYASENAIYGMGYTSSHLEQNSQLLIYKMN*