Sequence details bmy_17208 (Coding sequence)

Part of scaffold_1444 (Scaffold)

For more information consult the page for scaffold_1444 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

BT.48090 (Cow)   BCL2 (Human)   Bcl2 (Mouse)  

Genome Location

Sequence Coding sequence

Length: 225 bp    Location:241577..243021   Strand:+
Raw sequence 
>bmy_17208
ATGGCGCACCCTGGGAGAACAGGGTATGATAACCGGGAGATAGTGATGAAGTACATCCACTATAAGCTGTCGCAGAGGGGCTACGAGTGGGATGCCGGAGACGCGGGCGCGGCGTCCCCGGGGGCCGCCCCCGCTCCGGGCATCTTCTCCTCCCAGCCTGGGCGCACCCCAGCGCCATCCAGGACCTCCCCGCCGCCGCCCCAGACCGCCCCCGCCGCCCCCGCC

Related Sequences

bmy_17208T0 Protein

Length: 75 aa      
>bmy_17208T0
MAHPGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASPGAAPAPGIFSSQPGRTPAPSRTSPPPPQTAPAAPA