Sequence detailsbmy_17208 (Coding sequence)

Part of scaffold_1444 (SequenceType object (1))

For more information consult the page for scaffold_1444 (SequenceType object (1))

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

BT.48090 (Cow)   BCL2 (Human)   Bcl2 (Mouse)  

Genome Location

Sequence SequenceType object (2)

Length: 225 bp    Location:241577..243021   Strand:+
Raw sequence 
>bmy_17208
ATGGCGCACCCTGGGAGAACAGGGTATGATAACCGGGAGATAGTGATGAAGTACATCCACTATAAGCTGTCGCAGAGGGGCTACGAGTGGGATGCCGGAGACGCGGGCGCGGCGTCCCCGGGGGCCGCCCCCGCTCCGGGCATCTTCTCCTCCCAGCCTGGGCGCACCCCAGCGCCATCCAGGACCTCCCCGCCGCCGCCCCAGACCGCCCCCGCCGCCCCCGCC

Related Sequences

bmy_17208T0 SequenceType object (3)

Length: 75 aa      
>bmy_17208T0
MAHPGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASPGAAPAPGIFSSQPGRTPAPSRTSPPPPQTAPAAPA