Sequence details bmy_17943 (Coding sequence)

Part of scaffold_1667 (Scaffold)

For more information consult the page for scaffold_1667 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

C9ORF103 (Cow)   IDNK (Human)   Idnk (Mouse)  

Genome Location

Sequence Coding sequence

Length: 132 bp    Location:411494..408609   Strand:-
Raw sequence 
>bmy_17943
ATGTCCCCTGAGTTATTGCAGTCCCAGTTTGATACTCTGGAGCCCCCATCAGCTCCAGAAAATTTCATCCAAATCAGTGTGGACAAAAATCTTTCAGAGATAATTGCTACAATTATGGAAACTCTAAAATGA

Related Sequences

bmy_17943T0 Protein

Length: 44 aa      
>bmy_17943T0
MSPELLQSQFDTLEPPSAPENFIQISVDKNLSEIIATIMETLK*