Part of scaffold_1966 (Scaffold)

For more information consult the page for scaffold_1966 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

Genome Location

Sequence Coding sequence

Length: 177 bp    Location:66544..66817   Strand:+
>bmy_19105
ATGGCAGGTCCAGAAACTGATGCCCAGTACCAATTCACTGGTATCAAAAAATATTTCAACTCTTACACTCTCACAGGGAGAATGAATTGTGTCCTGGCCACATACGGAGGTATTGCTTTGATAGTTTTATACTTTAAGTTAAGGTCTAAAAAAACTCCAGCTGTGAAAGCAACATAA

Related Sequences

bmy_19105T0 Protein

Length: 59 aa     
>bmy_19105T0
MAGPETDAQYQFTGIKKYFNSYTLTGRMNCVLATYGGIALIVLYFKLRSKKTPAVKAT*