Sequence details bmy_19167 (Coding sequence)

Part of scaffold_1972 (Scaffold)

For more information consult the page for scaffold_1972 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

CAMK2N1 (Cow)   CAMK2N1 (Human)   Camk2n1 (Mouse)  

Genome Location

Sequence Coding sequence

Length: 237 bp    Location:113589..110471   Strand:-
Raw sequence 
>bmy_19167
ATGTCGGAGGTGCTGCCCTACGGCGACGAGAAGCTGAGCCCCTACGGCGACGGCGGCGACGTGGGCCAGATCTTCTCCTGCCGCCTGCAGGACACCAACAACTTCTTCGGCGCCGGGCAGAACAAGCGGCCGCCCAAGCTGGGCCAGATCGGCCGGAGCAAGCGGGTTGTTATTGAAGATGATAGGATTGATGACGTGCTGAAAAATATGACAGACAAGGCACCTCCTGGTGTCTAA

Related Sequences

bmy_19167T0 Protein

Length: 79 aa      
>bmy_19167T0
MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV*