Sequence details bmy_20039 (Coding sequence)

Part of scaffold_2342 (Scaffold)

For more information consult the page for scaffold_2342 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

(Human)   Ighv1-73 (Mouse)  

Genome Location

Sequence Coding sequence

Length: 234 bp    Location:20297..28079   Strand:+
Raw sequence 
>bmy_20039
ATGCTAAGCTGTGCAAGGACTGAATACAGACAACTCACCGTGGAGTCTGGGCTGAGCTGCTTTGTCTTTGTTGCTATTTTACAAGGTGTCCACTCCCACATCCAGCTGCTGCAGTCTGGCACTAAGGCAAAGAAGCCCAAGGCATCAGTGAATGTCTCCTGCAAGGCTTTCAGACACACCTTCACCAGCTGCTTTATGCACTTGGTTCAAAAGGCCTCTGGACAAGGGCTTTAG

Related Sequences

bmy_20039T0 Protein

Length: 78 aa      
>bmy_20039T0
MLSCARTEYRQLTVESGLSCFVFVAILQGVHSHIQLLQSGTKAKKPKASVNVSCKAFRHTFTSCFMHLVQKASGQGL*