Sequence details bmy_20324 (Coding sequence)

Part of scaffold_2414 (Scaffold)

For more information consult the page for scaffold_2414 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

PLAC8L1 (Cow)   PLAC8L1 (Human)   Plac8l1 (Mouse)  

Genome Location

Sequence Coding sequence

Length: 252 bp    Location:3068..4684   Strand:+
Raw sequence 
>bmy_20324
ATGTGTCTTGAGTGTGACATCGCCAGGCATTATGGAGAGTGTTTTTGTTGGCCATTGTTACCTGGGTCCACCTTTGCACTAAGAATTGGCACCAGAGAGAGACATAAAATACGGGGCACGCTGTGCGAGGACTGGCTGGCAGTGCACTGCTGCTGGCCTTTTTCCATCTGCCAGGTGGCCCGGGAACTCAAGATGAGGACCTCCCAACTCTACGACATCTACGCGGCCCCTTCGACTAAGGAAAATCTTATC

Related Sequences

bmy_20324T0 Protein

Length: 84 aa      
>bmy_20324T0
MCLECDIARHYGECFCWPLLPGSTFALRIGTRERHKIRGTLCEDWLAVHCCWPFSICQVARELKMRTSQLYDIYAAPSTKENLI