Part of scaffold_2709 (Scaffold)

For more information consult the page for scaffold_2709 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

Genome Location

Sequence Coding sequence

Length: 225 bp    Location:175474..167016   Strand:-
>bmy_20910
ATGATCAAGAATGAATTCAAAGAAGTTGAAAGTGCATATGAACGAGAAAAGCATAATGCACAAGAGAGCTTTGCAAAACTAAATATATTAGAAAGAGAGTATTTCTCCAAAAACAAGAAACTAAATGAAGAAATCGAGGAACAGAAGAAAGTAATTATAGACCTTTCAAAGAGACTCCAGTATAATGAAAAAAGTTGCAGTGAATTACAGGAAGAACTTGTAATG

Related Sequences

bmy_20910T0 Protein

Length: 75 aa     
>bmy_20910T0
MIKNEFKEVESAYEREKHNAQESFAKLNILEREYFSKNKKLNEEIEEQKKVIIDLSKRLQYNEKSCSELQEELVM