Sequence details bmy_21774 (Coding sequence)

Part of scaffold_3255 (Scaffold)

For more information consult the page for scaffold_3255 (Scaffold)

Potential Gene Matches

The following genes have been identified as possible orthologs in this organism.

Additional orthologs identified in other species via the OPTIC pipeline.

MGC137014 (Cow)  

Genome Location

Sequence Coding sequence

Length: 183 bp    Location:140633..138199   Strand:-
Raw sequence 
>bmy_21774
ATGAGGAACAGAAGTTCTGTCTTAGAAAAGCGTCAGGTCTCCACTAAAGAGTCCAGGCATCTCTCTGGCATGTTGACCCTGCCGCTGAGCGTAGGCAAGAAGGTGTGGCTAGAAGCAGAAGTGGAAACCAAGGAGCCAGAGCAAGCCACAGTTACAATCTATTTCTCTGGTTTCCTGACATAG

Related Sequences

bmy_21774T0 Protein

Length: 61 aa      
>bmy_21774T0
MRNRSSVLEKRQVSTKESRHLSGMLTLPLSVGKKVWLEAEVETKEPEQATVTIYFSGFLT*